PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0388s0045.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 200aa    MW: 22500.3 Da    PI: 7.8206
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0388s0045.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17e-322376255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH++Fv+a+++LGG+ekAtPk +l++m+v gLt++hvkSHLQ+YR+
  Kalax.0388s0045.2.p 23 PRLRWTPELHSCFVQAIDKLGGQEKATPKLLLQVMDVRGLTISHVKSHLQMYRS 76
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-301977IPR009057Homeodomain-like
PROSITE profilePS5129411.5341979IPR017930Myb domain
SuperFamilySSF466891.58E-152178IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-242377IPR006447Myb domain, plants
PfamPF002491.5E-72475IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MVSCGRGGGA GGGVRQYVRS KVPRLRWTPE LHSCFVQAID KLGGQEKATP KLLLQVMDVR  60
GLTISHVKSH LQMYRSIKSD LSRQVNLNSS DTSKQSFEDH DGDGDADEEQ DDDHNKMTLH  120
HHPSKPTSES DSHFVYNNSV DCINPPKRSV CSQTLTYIRQ SNKSNGEASC NYSLPLYCLF  180
TMCFAILPKY IIYFWSQYF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651000.13e-50PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLD7SMG82e-49D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t015e-49(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-31G2-like family protein